Chicken Secondary Antibodies
Kingfisher Biotech Inc Chicken ANG-4 Protein
The Chicken ANG-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken ANG-4 applications are for cell culture, ELISA standard, and Western Blot Control. Chicken ANG-4 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken ANG-4 Specifications: (Molecular Weight: 13.8 kDa) (Amino Acid Sequence: QNEGYEKFLR QHYDAKPKGR DDRYCESMMK ERKLTSPCKD VNTFIHGTKK NIRAICGKKG SPYGENFRIS NSPFQITTCT HSGASPRPPC GYRAFKDFRY IVIACEDGWP VHFDESFISP (120)) (Gene ID: 100302572). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken TNFSF15 Recombinant Protein
The Chicken TNFSF15 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken TNFSF15 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken TNFSF15 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 Specifications: (Molecular Weight: 19.1 kDa) (Amino Acid Sequence: ERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKRGLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPTQLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL) (Gene ID: 417247). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IL-4 Recombinant Protein
The Chicken IL-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-4 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IL-4 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-8 Specifications: (Molecular Weight: 12.4 kDa) (Amino Acid Sequence: LQLSVPLMES IRIVNDIQGE VSCVKMNVTD IFADNKTNNK TELLCKASTI VWESQHCHKN LQGLFLNMRQ LLNASSTSLK APCPTAAGNT TSMEKFLADL RTFFHQLAKN K) (Gene ID: 416330). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IFN gamma Recombinant Protein
The Chicken IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IFN gamma Specifications: (Molecular Weight: 16.7 kDa) (Amino Acid Sequence: HTASSLNLVQ LQDDIDKLKA DFNSSHSDVA DGGPIIVEKL KNWTERNEKR IILSQIVSMY LEMLENTDKS KPHIKHISEE LYTLKNNLPD GVKKVKDIMD LAKLPMNDLR IQRKAANELF SILQKLVDPP SFKRKRSQSQ RRCNC (145)) (Gene ID: 396054). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IFN gamma Recombinant Protein
The Chicken IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IFN gamma Specifications: (Molecular Weight: 16.7 kDa) (Amino Acid Sequence: HTASSLNLVQ LQDDIDKLKA DFNSSHSDVA DGGPIIVEKL KNWTERNEKR IILSQIVSMY LEMLENTDKS KPHIKHISEE LYTLKNNLPD GVKKVKDIMD LAKLPMNDLR IQRKAANELF SILQKLVDPP SFKRKRSQSQ RRCNC (145)) (Gene ID: 396054). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IL-2 Recombinant Protein
The Chicken IL-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-2 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IL-2 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-2 Specifications: (Molecular Weight: 14.0 kDa) (Amino Acid Sequence: ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK) (Gene ID: 373958). For research use only. Made in the USA